PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 488595
Common NameARALYDRAFT_488595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 388aa    MW: 43088.1 Da    PI: 9.0364
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
488595genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE++++v+a k++G   W++I +++g  +t+ q++s+ qk+
           488595 55 RERWTDEEHKKFVEALKLYGRA-WRRIEEHVG-SKTAVQIRSHAQKF 99
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-1649104IPR009057Homeodomain-like
PROSITE profilePS5129419.90850104IPR017930Myb domain
TIGRFAMsTIGR015571.3E-1653102IPR006447Myb domain, plants
SMARTSM007178.0E-1354102IPR001005SANT/Myb domain
PfamPF002493.7E-135598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-95595IPR009057Homeodomain-like
CDDcd001678.42E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MASSTLTANV QVLSPPSRNR DEEAGDKQIQ FNDQSFGGND YAPKVRKPYT ITKERERWTD  60
EEHKKFVEAL KLYGRAWRRI EEHVGSKTAV QIRSHAQKFF SKVAREATGG DGSSVEPIVI  120
PPPRPKRKPA HPYPRKFGND ADQTSRPVSP SERDNQSPTS VLSTVGSEAL GSLDSSSPNR  180
SLSPVSSASP PAALTTTANA PEELETLKLE LFPREILLNR ESSIKEPTKR SLKLFGKTVL  240
VSDSGMSSSL TSSTYCKSPI QPLPRKLSSS KTLPIIRNSQ EELLSCWIQV PLKQEDVENR  300
CLDSGKAVQN EGSSTGSNTG SVDDTGHTDK TSEPETMVWQ WEFKPSERSA FSELRRTNSE  360
SNSRGFGPYK KRKMVREEEE EEIRLHL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3788600.0AF378860.1 Arabidopsis thaliana AT5g17300/MKP11_15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873821.10.0myb family transcription factor
SwissprotF4KGY60.0RVE1_ARATH; Protein REVEILLE 1
TrEMBLD7LWZ30.0D7LWZ3_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.6__1729__AT5G17300.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.10.0MYB_related family protein